PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016486068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 92aa    MW: 10529.7 Da    PI: 4.4723
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016486068.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45.2e-112668145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++ +++eE+ l+++ +++ G++ W++Ia +++ gRt++++  + +
   XP_016486068.1 26 KLEFSEEEEMLIAKMFNLVGKR-WSLIAGRIP-GRTPEEIEKYCN 68
                     678*******************.*********.******998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.0752171IPR017877Myb-like domain
SMARTSM007174.4E-82573IPR001005SANT/Myb domain
PfamPF002499.3E-102769IPR001005SANT/Myb domain
CDDcd001673.04E-82869No hitNo description
SuperFamilySSF466893.59E-82869IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-122869IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MADEQSSTSD NTFVVSAETT TEETSKLEFS EEEEMLIAKM FNLVGKRWSL IAGRIPGRTP  60
EEIEKYCNTR YVIHKPASSI NEETRKLENN LQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768246.11e-62PREDICTED: transcription factor CPC-like
RefseqXP_016486068.11e-62PREDICTED: transcription factor CPC-like
SwissprotO220595e-17CPC_ARATH; Transcription factor CPC
TrEMBLB9HZL87e-30B9HZL8_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00390.12e-29(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.12e-14MYB_related family protein